PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S01532.10
Common NameJCGZ_02952, LOC105629930
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family G2-like
Protein Properties Length: 353aa    MW: 38378.5 Da    PI: 6.2255
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S01532.10genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.92.6e-29159212155
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    +prl+Wtp+LH+rFv++v+ L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Jcr4S01532.10 159 RPRLVWTPQLHKRFVDVVAYL-GIKNAVPKTIMQLMNVEGLTRENVASHLQKYRL 212
                    59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.77E-19156216IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.9E-30158217IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-22160212IPR006447Myb domain, plants
PfamPF002495.6E-7162211IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MGEEVKMSEY EANGDNTNVD EDRIAEWEIG LPTADDLTPL CQPLIPPELA SAFSISLEPN  60
KTILDVNRAS QNTLSSIRGG AAAGAGGGQF NALSSNNFKS YNEDRARESM EAEAEENNTD  120
PDGTGSESRK LRRLDSEEAD SALKTENSGD DPSARTLKRP RLVWTPQLHK RFVDVVAYLG  180
IKNAVPKTIM QLMNVEGLTR ENVASHLQKY RLYLKRMQGL SNEGPSSSDQ LFASTPVPQS  240
LHESGGGSVG GGSNGVGSGA APGKGHLGMP IPVPYHPAAG PMMPMPVYGH MGMQMGNNNH  300
HHHQQLNHHH QHGFDGNLPY NMLQQRDWSG NNYGSVMSHS HHPHRVVPPN DNM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-19158217463ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00014PBMTransfer from AT3G46640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012066973.10.0PREDICTED: transcription factor LUX
RefseqXP_012066974.10.0PREDICTED: transcription factor LUX
SwissprotQ9SNB46e-92PCL1_ARATH; Transcription factor LUX
TrEMBLA0A067L1F30.0A0A067L1F3_JATCU; Uncharacterized protein
STRINGPOPTR_0009s03990.11e-144(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF69573347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.27e-81G2-like family protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]